Gene Bio Systems
Recombinant Photosystem II reaction center protein H(psbH)
Recombinant Photosystem II reaction center protein H(psbH)
SKU:CSB-CF606679OCT
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Ostreococcus tauri
Uniprot NO.:Q0P3N4
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MAAKDSKLAGTGKVTALGTALRPLNSEYGKVAPGWGTTILMSVFIGLFAVFIVILLEIYN KSLILDNVGVNWLSSTGL
Protein Names:Recommended name: Photosystem II reaction center protein H Short name= PSII-H Alternative name(s): Photosystem II 10 kDa phosphoprotein
Gene Names:Name:psbH Ordered Locus Names:OtCpg00180
Expression Region:1-78
Sequence Info:full length protein
