Gene Bio Systems
Recombinant Photorhabdus luminescens subsp. laumondii UPF0266 membrane protein plu2700(plu2700)
Recombinant Photorhabdus luminescens subsp. laumondii UPF0266 membrane protein plu2700(plu2700)
SKU:CSB-CF762803PIJ
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Photorhabdus luminescens subsp. laumondii (strain TT01)
Uniprot NO.:Q7N3L5
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MNLNDIALTGLIVLMLAFAVYDEFVVNFLKGKTHLQIKLKRKHKIDALIFIILILIVVYN NITVYGSRLTTYLLLFTILVTIYIAYIRSPKLFFKNNGFFYANTFISYSRIKTMNLSEDG ILVIGLENKKLYISVSQIDDLERIYKFLIENR
Protein Names:Recommended name: UPF0266 membrane protein plu2700
Gene Names:Ordered Locus Names:plu2700
Expression Region:1-152
Sequence Info:full length protein
