Skip to product information
1 of 1

Gene Bio Systems

Recombinant Photorhabdus luminescens subsp. laumondii UPF0059 membrane protein plu2701(plu2701)

Recombinant Photorhabdus luminescens subsp. laumondii UPF0059 membrane protein plu2701(plu2701)

SKU:CSB-CF742206PIJ

Regular price $2,154.60 CAD
Regular price Sale price $2,154.60 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Photorhabdus luminescens subsp. laumondii (strain TT01)

Uniprot NO.:Q7N3L4

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNMYATLILALALSMDAFAASICKGAALHRPHFREAIRTGLIFGLAEACTPLIGWSLGLY ASQYIIEWDHWVAFTLLFILGCRMITESFKTKQEKKCESPCRHNSIVLITTAIATSLDAM AIGIGLAFLEVNIVHTAMAIGMMTMIMATLGMLIGRYIGPRLGKRAELIGGLILIAIGFN ILFEHLELFMYAK

Protein Names:Recommended name: UPF0059 membrane protein plu2701

Gene Names:Ordered Locus Names:plu2701

Expression Region:1-193

Sequence Info:full length protein

View full details