Skip to product information
1 of 1

Gene Bio Systems

Recombinant Photobacterium profundum ATP synthase subunit a 1(atpB1)

Recombinant Photobacterium profundum ATP synthase subunit a 1(atpB1)

SKU:CSB-CF764363PIG

Regular price $2,256.80 CAD
Regular price Sale price $2,256.80 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Photobacterium profundum (Photobacterium sp. (strain SS9))

Uniprot NO.:Q6LLG2

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAAPGEALTSSSYITHHLTNLAVGDGGFWTVHIDSLFFSVLTGLAFILVFHSVAKKATSG VPSKLQCFVEMLVEFVDNSVKETFHGRNPLIAPLGLTIFCWIMLMNIMDLIPIDFIPYAA EHALGIPYLKIVPTADVNITMAMALGVFALMLYYSVKVKGLGGFAKELALHPFNHPIMIP FNLLLEVVSLIAKPISLGMRLFGNMFAGEVVFILIAALMPWWAQWLGSVPWAIFHILIIT IQAFVFMMLTIVYLAQAHEDNH

Protein Names:Recommended name: ATP synthase subunit a 1 Alternative name(s): ATP synthase F0 sector subunit a 1 F-ATPase subunit 6 1

Gene Names:Name:atpB1 Ordered Locus Names:PBPRA3610

Expression Region:1-262

Sequence Info:full length protein

View full details