Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 22-32 working days
Research Topic: Others
Uniprot ID: P59368
Gene Names: PNTx4
Organism: Phoneutria nigriventer (Brazilian armed spider) (Ctenus nigriventer)
AA Sequence: CGDINAACKEDCDCCGYTTACDCYWSKSCKCREAAIVIYTAPKKKLTC
Expression Region: 35-82aa
Sequence Info: Full Length
Source: Yeast
Tag Info: N-terminal 6xHis-tagged
MW: 7.3 kDa
Alternative Name(s): Insecticidal neurotoxin Tx4(6-1) Short name:PNTx4(6-1)
Relevance: This neurotoxin binds at site 3 of insect voltage-activated sodium channels (Nav) and prolongs evoked axonal action potentials by a slowing down of sodium current inactivation. The toxin inhibits glutamate uptake from rat brain synaptosomes. It is highly toxic to house fly (Musca domestica), toxic to cockroach, but has no effect when intracerebroventricularly injected into mice.
Reference: "Molecular cloning of cDNAs encoding insecticidal neurotoxic peptides from the spider Phoneutria nigriventer."Penaforte C.L., Prado V.F., Prado M.A.M., Romano-Silva M.A., Guimaraes P.E.M., De Marco L., Gomez M.V., Kalapothakis E.Toxicon 38:1443-1449(2000)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer，50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.