Skip to product information
1 of 1

Gene Bio Systems

Recombinant Phaeodactylum tricornutum Photosystem I reaction center subunit XI(psaL)

Recombinant Phaeodactylum tricornutum Photosystem I reaction center subunit XI(psaL)

SKU:CSB-CF372017EUF

Regular price $2,091.60 CAD
Regular price Sale price $2,091.60 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Phaeodactylum tricornutum (strain CCAP 1055/1)

Uniprot NO.:A0T0M6

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MANFIKPYNDDPFVGHLATPITSSAVTRAILQNLPAYRFGLTPLLRGLEIGLAHGYFLMG PFVKLGPLRDSEIGLLAGFLSTVGLIVILTLGLTIYGVAAFGQEKTQSSNENDLQTKKAW DQFKGGFFVGACGSAGFAFICLSSIPSFITN

Protein Names:Recommended name: Photosystem I reaction center subunit XI Alternative name(s): PSI subunit V PSI-L

Gene Names:Name:psaL

Expression Region:1-151

Sequence Info:full length protein

View full details