Skip to product information
1 of 1

Gene Bio Systems

Recombinant Petunia sp. Chlorophyll a-b binding protein 37, chloroplastic(CAB37)

Recombinant Petunia sp. Chlorophyll a-b binding protein 37, chloroplastic(CAB37)

SKU:CSB-CF318201PGN

Regular price $2,206.40 CAD
Regular price Sale price $2,206.40 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Petunia sp. (Petunia)

Uniprot NO.:P12062

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:RRTVKSAPQSIWYGEDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNREL EVIHCRWAMLGALGCVFPEILSKNGVTFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSI LAIWAAQVVLMGFVEGYRVGGGPLGEGLDKIYPGGAFDPLGLADDPEAFAELKVKEIKNG RLAMFSMFGFFVQAIVTGKGPIENLYDHVADPVANNAWAFATNFVPGK

Protein Names:Recommended name: Chlorophyll a-b binding protein 37, chloroplastic Alternative name(s): LHCII type I CAB-37 Short name= LHCP

Gene Names:Name:CAB37

Expression Region:38-265

Sequence Info:full length protein

View full details