Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 22-32 working days
Research Topic: Others
Uniprot ID: O66377
Gene Names: cry1Fb
Organism: Bacillus thuringiensis subsp. morrisoni
AA Sequence: VKGHVDVEEQNNHRSVLVVPEWEAEVSQEVRVCPGRGYILRVTAYKEGYGEGCVTIHEVDNNTDELKFSSNCEKEQVYPGNTVACNDYNKNHGANACSSRNGGYDESYESNSSIPADYAPVYEEEAYTDGQRGNPCEFNRGHTPLPAGYVTAELEYFPETDTVWVEIGETEGTFIVDSVELLLMEE
Expression Region: 984-1169aa
Sequence Info: Partial
Source: Yeast
Tag Info: N-terminal 6xHis-tagged
MW: 21.6 kDa
Alternative Name(s): 132KDA crystal protein Crystaline entomocidal protoxin Insecticidal delta-endotoxin CryIF(b)
Relevance: Promotes colloidosmotic lysis by binding to the midgut epithelial cells of insects.
Reference: "A novel cry1Fb gene from Bacillus thuringiensis subsp. morrisoni."Song F., Zhang J., Ding Z., Chen Z., Li G., Huang D.
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer，50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.