Gene Bio Systems
Recombinant Penicillium marneffei Altered inheritance of mitochondria protein 31, mitochondrial(aim31)
Recombinant Penicillium marneffei Altered inheritance of mitochondria protein 31, mitochondrial(aim31)
SKU:CSB-CF471984ETM
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Penicillium marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)
Uniprot NO.:B6QHL9
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MCSDFEEETSIQKFKRRLKEEPLIPLGCAATCYALYRAYRSGKAKDSVEMNRMFRARIYA QFFTLLAVVAGGMYYKTERKQRREFEKKVEERKAQEKRDAWLRELEARDKEDKGWKERHA AVSVTAKKETEGAVDKNVNQAPTEEVVEKRGTGILDAVKALVQGKKD
Protein Names:Recommended name: Altered inheritance of mitochondria protein 31, mitochondrial
Gene Names:Name:aim31 ORF Names:PMAA_094690
Expression Region:1-167
Sequence Info:full length protein
