Gene Bio Systems
Recombinant Pelobacter propionicus ATP synthase subunit a 1(atpB1)
Recombinant Pelobacter propionicus ATP synthase subunit a 1(atpB1)
SKU:CSB-CF372456PYF
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Pelobacter propionicus (strain DSM 2379)
Uniprot NO.:A1ALL0
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MVHPLLFLEFFRKLLEPLHMSEAGADAVAYTWLIMLLLLLFSFLATRALKMIPCGLQNFM EVVVGGVENMIVETMGEHGRPYFPLVATVGLFVLVSNLIGLIPGFFPPTANINTTAACAI VVFIATHVVGIKRHGIGYIKHFCGPILWLAPVMFFIEVIGHLSRPLSLTLRLFGNMNGHE LVLIIFFGLAPFLVPLPMMLMGVLVSFIQAFVFMLLTMIYIQGSLEEAH
Protein Names:Recommended name: ATP synthase subunit a 1 Alternative name(s): ATP synthase F0 sector subunit a 1 F-ATPase subunit 6 1
Gene Names:Name:atpB1 Ordered Locus Names:Ppro_0599
Expression Region:1-229
Sequence Info:full length protein
