Gene Bio Systems
Recombinant Pelobacter carbinolicus ATP synthase subunit a 2(atpB2)
Recombinant Pelobacter carbinolicus ATP synthase subunit a 2(atpB2)
SKU:CSB-CF662655PAAO
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1)
Uniprot NO.:Q3A603
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MTHPFVLLKWLIAKLHFGFSAEMLEQHGFFQHVTHTWLVMAILIGVGLLATHRAGLVPGG MQNFMELVLVEIRGMVRDTMGPKGMVYFPLIATLALFLLVSNLIGLIPGFAPPTASLNTN AALAVGVFLVTHIVGVREHGIRYFKHFMGPVWWLTPLILPIELIGHLARPLSLSLRLFGN MYGHEIVLMIFFSLVPLLLPIPMMLMGILVAFIQTFVFMLLSMIYIAGALEEAH
Protein Names:Recommended name: ATP synthase subunit a 2 Alternative name(s): ATP synthase F0 sector subunit a 2 F-ATPase subunit 6 2
Gene Names:Name:atpB2 Ordered Locus Names:Pcar_0951
Expression Region:1-234
Sequence Info:full length protein
