Gene Bio Systems
Recombinant Pectobacterium carotovorum subsp. carotovorum UPF0442 protein PC1_3642 (PC1_3642)
Recombinant Pectobacterium carotovorum subsp. carotovorum UPF0442 protein PC1_3642 (PC1_3642)
SKU:CSB-CF511935ESQ
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Uniprot NO.:C6DEZ3
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MGLSLLWALLQDMALAAVPALGFAMVFNVPLKVLPYCALLGGVGHGVRFLAMHFGMNIEW ASFLAAILIGIIGIRWSRWLLAHPKVFTVAAVIPMFPGISAYTAMISVVEISHLGYSEAL MSVMITNFLKASFIVGALSIGLSLPGIWLYRKRPGV
Protein Names:Recommended name: UPF0442 protein PC1_3642
Gene Names:Ordered Locus Names:PC1_3642
Expression Region:1-156
Sequence Info:full length protein
