
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 22-32 working days
Research Topic: Others
Uniprot ID: P55958
Gene Names: N/A
Organism: Parietaria judaica (Pellitory-of-the-wall) (Parietaria diffusa)
AA Sequence: EEACGKVVQDIMPCLHFVKGEEKEPSKECCSGTKKLSEEVKTTEQKREACKCIVRATKGISGIKNELVAEVPKKCDIKTTLPPITADFDCSKIQSTIFRGYY
Expression Region: 32-133aa
Sequence Info: Full Length of Mature Protein
Source: Yeast
Tag Info: N-terminal 6xHis-tagged
MW: 13.3 kDa
Alternative Name(s): Allergen Par j II Major pollen allergen Par j 2.0101 Protein P2 Allergen: Par j 2.0101
Relevance: Plant non-specific lipid-transfer proteins transfer phospholipids as well as galactolipids across membranes. May play a role in wax or cutin deposition in the cell walls of expanding epidermal cells and certain secretory tissues.
Reference: "Assignment of disulphide bridges in Par j 2.0101, a major allergen of Parietaria judaica pollen." Amoresano A., Pucci P., Duro G., Colombo P., Costa M.A., Izzo V., Lamba D., Geraci D. Biol. Chem. 384:1165-1172(2003)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.