Skip to product information
1 of 1

Gene Bio Systems

Recombinant Paralichthys olivaceus Probable Bax inhibitor 1(tmbim6)

Recombinant Paralichthys olivaceus Probable Bax inhibitor 1(tmbim6)

SKU:CSB-CF884857ERT

Regular price $2,219.00 CAD
Regular price Sale price $2,219.00 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Paralichthys olivaceus (Japanese flounder) (Hippoglossus olivaceus)

Uniprot NO.:Q9IA79

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNVFDRNINFDSLFKFSQISHSTQVHLKNVYSSLAVCMFVAAAGSYVHVVTRLFQGGMLS VLGSLGMMFWLAMTPHNSETEKKRLAILAGFAFLTGVGLCPTLDFVIAINPSIIVTAFLG TSVIFVCFTLSALYAKRRSYLFLGGTLMSGLSILFLMSMMNMFFGSVMLFKAHMYLGLLI MCGFVLXDTQLIIEKAENGDKDYVWHSVDLFLDFITIFRKLMVILALNDKDKKKEKK

Protein Names:Recommended name: Probable Bax inhibitor 1 Short name= BI-1 Alternative name(s): Testis-enhanced gene transcript protein homolog Transmembrane BAX inhibitor motif-containing protein 6

Gene Names:Name:tmbim6 Synonyms:tegt

Expression Region:1-237

Sequence Info:full length protein

View full details