Skip to product information
1 of 1

Gene Bio Systems

Recombinant Paracoccidioides brasiliensis Altered inheritance of mitochondria protein 31, mitochondrial(AIM31)

Recombinant Paracoccidioides brasiliensis Altered inheritance of mitochondria protein 31, mitochondrial(AIM31)

SKU:CSB-CF507980ERP

Regular price $2,081.80 CAD
Regular price Sale price $2,081.80 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Paracoccidioides brasiliensis (strain Pb03)

Uniprot NO.:C0RYW2

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSNTSLPSSFDSHPEFFQETKWQKFTRRIKEEPLIPIGYAATSYALWRAYKSMKAGDSIE LNRMFRARIYGHAFTLFAIVAGGIYYGNERRQRKEFEKALQEKSNQQKRDSWLRELEIRD KEDKDWRQRHAAIEAAAKEAEKKG

Protein Names:Recommended name: Altered inheritance of mitochondria protein 31, mitochondrial

Gene Names:Name:AIM31 ORF Names:PABG_00617

Expression Region:1-144

Sequence Info:full length protein

View full details