Skip to product information
1 of 1

Gene Bio Systems

Recombinant Papio anubis Insulin-induced gene 2 protein(INSIG2)

Recombinant Papio anubis Insulin-induced gene 2 protein(INSIG2)

SKU:CSB-CF011746ERI-GB

Regular price $2,200.80 CAD
Regular price Sale price $2,200.80 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Papio anubis (Olive baboon)

Uniprot NO.:A9RA88

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAEGETESPGPKKCGPYISSVTSQSVNLMIRGVVLFFIGVFLALVLNLLQIQRNVTLFPP DVIASIFSSAWWVPPCCGTASAVIGLLYPCIDRHLGEPHKFKREWSSVMRCVAVFVGINH ASAKVDFDNNIQLSLTLAALSIGLWWTFDRSRSGFGLGVGIAFLATLVTQLLVYNGVYQY TSPDFLYVRSWLPCIFFAGGITMGNIGRQLAMYECKVIAEKSHQE

Protein Names:Recommended name: Insulin-induced gene 2 protein Short name= INSIG-2

Gene Names:Name:INSIG2

Expression Region:1-225

Sequence Info:full length protein

View full details