Skip to product information
1 of 1

Gene Bio Systems

Recombinant Pan troglodytes TYRO protein tyrosine kinase-binding protein(TYROBP)

Recombinant Pan troglodytes TYRO protein tyrosine kinase-binding protein(TYROBP)

SKU:CSB-CF025398EQV

Regular price $1,996.40 CAD
Regular price Sale price $1,996.40 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Pan troglodytes (Chimpanzee)

Uniprot NO.:A4F4L0

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:QAQSDCSCSTVSPGVLAGIVMGDLVLTVLIALAVYFLGRLVHRGRGAAEAATRKQRITETESPYQELQGQRSDVYSDLNMQRPYYK

Protein Names:Recommended name: TYRO protein tyrosine kinase-binding protein

Gene Names:Name:TYROBP

Expression Region:28-113

Sequence Info:full length protein

View full details