Recombinant Pan troglodytes NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial(NDUFB11)

CSB-CF612649EQV

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Pan troglodytes (Chimpanzee)

Uniprot NO.:Q0MQJ5

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:ESSFSRTVVAPSAVAGKRPPEPTTQWQEDPEPEDENLYEKNPDSHGYDKDPVLDVWNMRL VFFFGVSIILVLGSTFVAYLPDYRMKEWSRREAERLVKYREANGLPIMESNCFDPSKIQL PEDE

Protein Names:Recommended name: NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial Alternative name(s): Complex I-ESSS Short name= CI-ESSS NADH-ubiquinone oxidoreductase ESSS subunit

Gene Names:Name:NDUFB11

Expression Region:30-153

Sequence Info:full length protein