Gene Bio Systems
Recombinant Pan troglodytes Glycophorin-B(GYPB)
Recombinant Pan troglodytes Glycophorin-B(GYPB)
SKU:CSB-CF631735EQV
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Pan troglodytes (Chimpanzee)
Uniprot NO.:Q28914
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:SSTTEVAMHTSTSSSVTKSYISSQTNDKHKGDTYPATLGAHEVSEISVTTVYPPEEDNGE WVQPVHPFSRPAPVVIILIILCVMAGVIGTILLISYGIRLLIKA
Protein Names:Recommended name: Glycophorin-B Alternative name(s): CD_antigen= CD235b
Gene Names:Name:GYPB Synonyms:GPB
Expression Region:20-123
Sequence Info:full length protein
