Skip to product information
1 of 1

Gene Bio Systems

Recombinant Pan troglodytes Glycophorin-B(GYPB)

Recombinant Pan troglodytes Glycophorin-B(GYPB)

SKU:CSB-CF631735EQV

Regular price $2,023.00 CAD
Regular price Sale price $2,023.00 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Pan troglodytes (Chimpanzee)

Uniprot NO.:Q28914

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:SSTTEVAMHTSTSSSVTKSYISSQTNDKHKGDTYPATLGAHEVSEISVTTVYPPEEDNGE WVQPVHPFSRPAPVVIILIILCVMAGVIGTILLISYGIRLLIKA

Protein Names:Recommended name: Glycophorin-B Alternative name(s): CD_antigen= CD235b

Gene Names:Name:GYPB Synonyms:GPB

Expression Region:20-123

Sequence Info:full length protein

View full details