Recombinant Oxyuranus microlepidotus Toxin 3FTx-Oxy6

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Oxyuranus microlepidotus Toxin 3FTx-Oxy6

CSB-EP415963OGE
Regular price
$1,332.50 CAD
Sale price
$1,332.50 CAD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20171228

Research areas: Others

Target / Protein: N/A

Biologically active: Not Tested

Expression system: E.coli

Species of origin: Oxyuranus microlepidotus (Inland taipan)

Delivery time: 3-7 business days

Uniprot ID: A7X4T2

AA Sequence: LKCHESENLDDHVVCEEDETMCYKFTFVPFRDFEIVARGCSASCPEEKDVVCCSTDLCNK

Tag info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Expression Region: 22-81aa

Protein length: Full Length of Mature Protein

MW: 26.9 kDa

Alternative Name(s):

Relevance:

Reference: "Evolution of an arsenal: structural and functional diversification of the venom system in the advanced snakes (Caenophidia)." Fry B.G., Scheib H., van der Weerd L., Young B., McNaughtan J., Ramjan S.F.R., Vidal N., Poelmann R.E., Norman J.A. Mol. Cell. Proteomics 7:215-246(2008)

Purity: Greater than 85% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share