Skip to product information
1 of 1

Gene Bio Systems

Recombinant Oxaloacetate decarboxylase gamma chain(oadG)

Recombinant Oxaloacetate decarboxylase gamma chain(oadG)

SKU:CSB-CF318325KBG

Regular price $1,778.75 CAD
Regular price Sale price $1,778.75 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Klebsiella pneumoniae

Uniprot NO.:P13155

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTDNAVLLGEGFTLMCLGMGFVLVFLLLLIFAIRGMSLAVNRLFPEPPAAPKPAPAAVAP ADDFARLKPAIVAAIHHHRRLHP

Protein Names:Recommended name: Oxaloacetate decarboxylase gamma chain EC= 4.1.1.3

Gene Names:Name:oadG

Expression Region:1-83

Sequence Info:full length protein

View full details