Skip to product information
1 of 1

Gene Bio Systems

Recombinant Oryza sativa subsp. japonica Vacuolar iron transporter homolog 2 (Os04g0538400, LOC_Os04g45520)

Recombinant Oryza sativa subsp. japonica Vacuolar iron transporter homolog 2 (Os04g0538400, LOC_Os04g45520)

SKU:CSB-CF469675OFG

Regular price $2,147.60 CAD
Regular price Sale price $2,147.60 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Oryza sativa subsp. japonica (Rice)

Uniprot NO.:B7F138

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MARAQWLRAAVLGANDGLVSVASLMIGIGAVNENNKAMLVSGLAGLVAGACSMAIGEFVS VYAQYDIEVTQIERDGDIDGADAAAAREKLPSPTQAAFASALAFAIGGLLPLLTSGFIKP WGPRVGVVCAASSVGLAGFGAAGGYLGGANMVRSGTRVLLGGWLAMLITYAVLRLFATIF HGMNISSSA

Protein Names:Recommended name: Vacuolar iron transporter homolog 2 Alternative name(s): Protein NODULIN-LIKE 2

Gene Names:Ordered Locus Names:Os04g0538400, LOC_Os04g45520 ORF Names:OSJNBa0091D06.17

Expression Region:1-189

Sequence Info:full length protein

View full details