Skip to product information
1 of 1

Gene Bio Systems

Recombinant Oryza sativa subsp. japonica Secretory carrier-associated membrane protein 6(SCAMP6)

Recombinant Oryza sativa subsp. japonica Secretory carrier-associated membrane protein 6(SCAMP6)

SKU:CSB-CF610267OFG

Regular price $2,272.20 CAD
Regular price Sale price $2,272.20 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Oryza sativa subsp. japonica (Rice)

Uniprot NO.:Q0JAI9

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MHHDPNPFDEGNADDNPFSNGGGGGGGGGSRQQYGFRPTEPAGFGAGRGDATVDVPLDTM GDSKSKARELSSWETDLKRREADIKRREEALRNAGVPMEDKNWPPFFPIIHHDIANEIPA NLQKLQYLAFASWLGIVLCLSWNFIAVIVCWIKEGDSKLFFLATIYALLGIPLSYLIWYR PLYRAMRTNSAFSFGWFFLCYLIHIGFCIIAAIAPPIVFHGKSLTGILAAIDTFSEHVII GIFYFVGFALFCLETLLSIGVLQRVYMYFRGNK

Protein Names:Recommended name: Secretory carrier-associated membrane protein 6 Short name= Secretory carrier membrane protein 6

Gene Names:Name:SCAMP6 Ordered Locus Names:Os04g0597000, Os04g0595800, LOC_Os04g50890 ORF Names:OsJ_16007, OSJNBa0006A01.24, OSJNba0093F12.6

Expression Region:1-273

Sequence Info:full length protein

View full details