Skip to product information
1 of 1

Gene Bio Systems

Recombinant Oryza sativa subsp. japonica Secretory carrier-associated membrane protein 3(SCAMP3)

Recombinant Oryza sativa subsp. japonica Secretory carrier-associated membrane protein 3(SCAMP3)

SKU:CSB-CF736787OFG

Regular price $2,286.20 CAD
Regular price Sale price $2,286.20 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Oryza sativa subsp. japonica (Rice)

Uniprot NO.:Q60EA5

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAGKHGRNGFEDDDVNPFAGGSVPPANNSRLPPLSHEPADFYNVDIPLDSSKDLKKKEKE LQAMEAELNKRERELKRKEEAAAQAGIVIEDKNWPPFFPLIHHNISNEIPIHLQRMQYLA FSSFLGLAACLFWNIIATTTAWVKGEGVIIWLLAIIYFISGVPGAYVLWYRPLYNAMRTE SALKFGWFFLFYLIHIIFCVWAAVAPPFPFKGKSLAGILPAIDVIGRSAIVGIFYFVGFG LFCLESLLSIGVIQQVYMYFRGSGKAAEMKREAARGALSSAF

Protein Names:Recommended name: Secretory carrier-associated membrane protein 3 Short name= Secretory carrier membrane protein 3

Gene Names:Name:SCAMP3 Ordered Locus Names:Os05g0503000, LOC_Os05g42330 ORF Names:OSJNBa0017K09.16, OSJNBb0048K05.1

Expression Region:1-282

Sequence Info:full length protein

View full details