Skip to product information
1 of 1

Gene Bio Systems

Recombinant Oryza sativa subsp. japonica Probable protein-S-isoprenylcysteine O-methyltransferase(ICMT)

Recombinant Oryza sativa subsp. japonica Probable protein-S-isoprenylcysteine O-methyltransferase(ICMT)

SKU:CSB-CF773725OFG

Regular price $2,151.80 CAD
Regular price Sale price $2,151.80 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Oryza sativa subsp. japonica (Rice)

Uniprot NO.:Q7XSR9

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAARAQAWLFAAALVIFHGSEYVLAAAFHGRRNVTATSLLISKQYVLAMSFAMLEHLTEA LLFPELKEYWFVSYVGLVMVIIGEVIRKLAVVTAGRSFTHVIRIHYEDQHKLITHGVYRL MRHPGYSGFLIWAVGTQVMLCNPLSTVAFTLVLWRFFSKRIPYEEFFLRQFFGREYEEYA QKVHSGLPFIE

Protein Names:Recommended name: Probable protein-S-isoprenylcysteine O-methyltransferase EC= 2.1.1.100 Alternative name(s): Isoprenylcysteine carboxylmethyltransferase Prenylated protein carboxyl methyltransferase Prenylcysteine carboxyl methyltr

Gene Names:Name:ICMT Ordered Locus Names:Os04g0602900, LOC_Os04g51380 ORF Names:OsJ_015369, OSJNBa0041A02.18

Expression Region:1-191

Sequence Info:full length protein

View full details