Skip to product information
1 of 1

Gene Bio Systems

Recombinant Oryza sativa subsp. japonica Probable aquaporin TIP1-1(TIP1-1)

Recombinant Oryza sativa subsp. japonica Probable aquaporin TIP1-1(TIP1-1)

SKU:CSB-CF342272OFG

Regular price $2,238.60 CAD
Regular price Sale price $2,238.60 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Oryza sativa subsp. japonica (Rice)

Uniprot NO.:P50156

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MPIRNIAVGSHQEVYHPGALKAALAEFISTLIFVFAGQGSGMAFSKLTGGGATTPAGLIA AAVAHAFALFVAVSVGANISGGHVNPAVTFGAFVGGNITLFRGLLYWIAQLLGSTVACFL LRFSTGGLATGTFGLTGVSVWEALVLEIVMTFGLVYTVYATAVDPKKGSLGTIAPIAIGF IVGANILVGGAFDGASMNPAVSFGPALVSWSWESQWVYWVGPLIGGGLAGVIYEVLFISH THEQLPTTDY

Protein Names:Recommended name: Probable aquaporin TIP1-1 Alternative name(s): Tonoplast intrinsic protein 1-1 Short name= OsTIP1;1 rTIP1

Gene Names:Name:TIP1-1 Synonyms:YK333 Ordered Locus Names:Os03g0146100, LOC_Os03g05290 ORF Names:OsJ_009057, OSJNBa0067N01.16

Expression Region:1-250

Sequence Info:full length protein

View full details