Skip to product information
1 of 1

Gene Bio Systems

Recombinant Oryza sativa subsp. japonica Probable aquaporin PIP2-7(PIP2-7)

Recombinant Oryza sativa subsp. japonica Probable aquaporin PIP2-7(PIP2-7)

SKU:CSB-CF723826OFG

Regular price $2,297.40 CAD
Regular price Sale price $2,297.40 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Oryza sativa subsp. japonica (Rice)

Uniprot NO.:Q651D5

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MASKEEVAVETVEGGAAAAKAPYWDPPPAPLLDTSELGKWSLYRALIAEFMATLIFLYVS IATVIGYKNQRATVDACTGVGYLGVAWSFGATIFVLVYCTGGVSGGHINPAVTLGLFFGR KLSLVRTVLYVVAQCLGAIAGAGIVKGIMKRPYDALGGGANTVSDGYSAAGALGAEIVGT FILVYTVFSATDPKRTARDSFIPVLVPLPIGFAVFVVHLATIPITGTGINPARSLGAAVL YNQHAAWKDHWIFWVGPVIGAFLAAAYHKLVLRGEAAKALSSFRSTSVTA

Protein Names:Recommended name: Probable aquaporin PIP2-7 Alternative name(s): OsPIP2;7 Plasma membrane intrinsic protein 2-7

Gene Names:Name:PIP2-7 Ordered Locus Names:Os09g0541000, LOC_Os09g36930 ORF Names:B1274F11.29-1, B1274F11.29-2, P0478E02.3

Expression Region:1-290

Sequence Info:full length protein

View full details