Skip to product information
1 of 1

Gene Bio Systems

Recombinant Oryza sativa subsp. japonica Peroxisomal membrane protein 11-1(PEX11-1)

Recombinant Oryza sativa subsp. japonica Peroxisomal membrane protein 11-1(PEX11-1)

SKU:CSB-CF604686OFG

Regular price $2,219.00 CAD
Regular price Sale price $2,219.00 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Oryza sativa subsp. japonica (Rice)

Uniprot NO.:Q10SM7

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSTLDATRAELGLVVLYLNKAEARDKICRAIQYGSKFISNGQPGTAQDVDRSTTLARKVF RLLKWVNDLHGLISPPAKGTPLTLVLLGKSKNALLSTFLFLDQFVWLGRTGIYKNKERTD RIVRISLYCWMASSVCAGLVELGELKRLSKSMRKLARELRDTDKYENDQYKSKMKQSDER LLALVKAAMDVVVAVGLLQLSPKKITPRVTGAFGFVTSLISCYQQLPSRAPAIKVKA

Protein Names:Recommended name: Peroxisomal membrane protein 11-1 Alternative name(s): OsPEX11-1 Peroxin-11-1

Gene Names:Name:PEX11-1 Ordered Locus Names:Os03g0117100, LOC_Os03g02590

Expression Region:1-237

Sequence Info:full length protein

View full details