Skip to product information
1 of 1

Gene Bio Systems

Recombinant Oryza sativa subsp. japonica Copper transporter 1(COPT1)

Recombinant Oryza sativa subsp. japonica Copper transporter 1(COPT1)

SKU:CSB-CF836016OFG

Regular price $2,107.00 CAD
Regular price Sale price $2,107.00 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Oryza sativa subsp. japonica (Rice)

Uniprot NO.:Q94EE4

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MDMGGHDMGGMSPPAAGAAAQGGMGAMKSMRYTHMTFFWGKNSEVLFTMWPGTRGGMYAL ALIFVFALAVIVEFLGSRRADACLAALARRAPAAGGLARAAVHTVRVGVAYLLMLALMSF NGGVFLVAVAGHAAGFLAFRAGLCGGPAQVEEDRKNDPACC

Protein Names:Recommended name: Copper transporter 1 Short name= OsCOPT1

Gene Names:Name:COPT1 Ordered Locus Names:Os01g0770700, LOC_Os01g56420 ORF Names:P0665A11.22

Expression Region:1-161

Sequence Info:full length protein

View full details