Gene Bio Systems
Recombinant Oryza sativa subsp. japonica Copper transporter 1(COPT1)
Recombinant Oryza sativa subsp. japonica Copper transporter 1(COPT1)
SKU:CSB-CF836016OFG
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Oryza sativa subsp. japonica (Rice)
Uniprot NO.:Q94EE4
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MDMGGHDMGGMSPPAAGAAAQGGMGAMKSMRYTHMTFFWGKNSEVLFTMWPGTRGGMYAL ALIFVFALAVIVEFLGSRRADACLAALARRAPAAGGLARAAVHTVRVGVAYLLMLALMSF NGGVFLVAVAGHAAGFLAFRAGLCGGPAQVEEDRKNDPACC
Protein Names:Recommended name: Copper transporter 1 Short name= OsCOPT1
Gene Names:Name:COPT1 Ordered Locus Names:Os01g0770700, LOC_Os01g56420 ORF Names:P0665A11.22
Expression Region:1-161
Sequence Info:full length protein
