Gene Bio Systems
Recombinant Oryza sativa subsp. japonica Chlorophyll a-b binding protein, chloroplastic(RCABP89)
Recombinant Oryza sativa subsp. japonica Chlorophyll a-b binding protein, chloroplastic(RCABP89)
SKU:CSB-CF606059OFG
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Oryza sativa subsp. japonica (Rice)
Uniprot NO.:Q10HD0
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:RRTVKSAPQSIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNREL EVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLVHAQSI LAIWAVQVVLMGFVEGYRVGGGPLGEGLDKVYPGGAFDPLGLADDPDTFAELKVKELKNG RLAMFSMFGFFVQAIVTGKGPIENLFDHVADPVANNAWAYATNFVPGK
Protein Names:Recommended name: Chlorophyll a-b binding protein, chloroplastic Alternative name(s): LHCII type I CAB Short name= LHCP
Gene Names:Name:RCABP89 Ordered Locus Names:Os03g0592500, LOC_Os03g39610 ORF Names:OsJ_011145, OSJNBb0056O10.8
Expression Region:36-263
Sequence Info:full length protein
