Skip to product information
1 of 1

Gene Bio Systems

Recombinant Oryza sativa subsp. japonica Casparian strip membrane protein Os02g0743900(Os02g0743900, LOC_Os02g51010)

Recombinant Oryza sativa subsp. japonica Casparian strip membrane protein Os02g0743900(Os02g0743900, LOC_Os02g51010)

SKU:CSB-CF754521OFG

Regular price $2,165.80 CAD
Regular price Sale price $2,165.80 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Oryza sativa subsp. japonica (Rice)

Uniprot NO.:Q6Z2U5

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MEGKAAVTTSTEHGDGEASRTAARTVVSGSSRGGAASRALSVADLILRVVAVVAIVDSAI AMGTTNQTLPFFTQFLRFKAQYSDLPTLTLFVVANSAVTAYLVLSIPLSVVHIIRSRASY SRLVLIFLDSVMLALVAAVASASAAIVYLAHKGNVRANWFAVCQQFDSFCERISGPLIGS FAAMAVLLLLVLLSAAALARR

Protein Names:Recommended name: Casparian strip membrane protein Os02g0743900

Gene Names:Ordered Locus Names:Os02g0743900, LOC_Os02g51010 ORF Names:OJ1734_E02.23

Expression Region:1-201

Sequence Info:full length protein

View full details