Skip to product information
1 of 1

Gene Bio Systems

Recombinant Oryza sativa subsp. japonica CASP-like protein Os07g0442900(Os07g0442900, LOC_Os07g26110)

Recombinant Oryza sativa subsp. japonica CASP-like protein Os07g0442900(Os07g0442900, LOC_Os07g26110)

SKU:CSB-CF744361OFG

Regular price $2,174.20 CAD
Regular price Sale price $2,174.20 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Oryza sativa subsp. japonica (Rice)

Uniprot NO.:Q6YT98

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MATVDGTTAPSSGGKTATVALESGGGRYGGPAPAKCSGANLALRALLFAVSLSALVVLVT AKQTVMVPFVIRPPQFILAPVPAKYTHSPALIYLLAALCATCFYSLITAISSVRLLSSSA CSAKTLFYLILLDVFYAAVMASATGTAGAVAWVGLKGNSHTRWNKICNVYGKFCRHIGSS TFLALIAAIVLVLLAFLNAYSLYRRSR

Protein Names:Recommended name: CASP-like protein Os07g0442900

Gene Names:Ordered Locus Names:Os07g0442900, LOC_Os07g26110 ORF Names:B1157F01.19, OsJ_023119

Expression Region:1-207

Sequence Info:full length protein

View full details