Skip to product information
1 of 1

Gene Bio Systems

Recombinant Oryza sativa subsp. japonica CASP-like protein Os03g0817100 (Os03g0817100, LOC_Os03g60250)

Recombinant Oryza sativa subsp. japonica CASP-like protein Os03g0817100 (Os03g0817100, LOC_Os03g60250)

SKU:CSB-CF497861OFG

Regular price $2,161.60 CAD
Regular price Sale price $2,161.60 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Oryza sativa subsp. japonica (Rice)

Uniprot NO.:B9F6Z0

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSSSGPPAGDGRDDASGPGPAGAAAAADGSVPVSRSIVERWKMEPAAARARLLLRAVAWL FSLLALVVMASNKHGHGGAQDFDNYPEYTYCLGISIIAVLYTTAQVTRDVHRLSWGRDVI AGRKAAAVVDFAGDQVVAYLLMSALSAAAPVTDYMRQAADNLFTDSAAAAISMAFLAFLA AGLSALVSGYNLAMEVLV

Protein Names:Recommended name: CASP-like protein Os03g0817100

Gene Names:Ordered Locus Names:Os03g0817100, LOC_Os03g60250 ORF Names:OsJ_13110, OSJNBa0094J08.19

Expression Region:1-198

Sequence Info:full length protein

View full details