Gene Bio Systems
Recombinant Oryza sativa subsp. japonica CASP-like protein BLE3(BLE3)
Recombinant Oryza sativa subsp. japonica CASP-like protein BLE3(BLE3)
SKU:CSB-CF774615OFG
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Oryza sativa subsp. japonica (Rice)
Uniprot NO.:Q84UT5
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MAKVHRLMNAVLRLAAAAAAATAAVVMVTSRETTSFFGIQMEAKYSYTPSFIFFVVAYAV AAAYSLLVLAVPAGSALSRLALTTDVVLGMVLAGAVASAGAISDIAKNGNSHAGWLPVCG QIHAYCNHVMAALIAGFVALAVHFVVVMYSLHIVTDVICPCH
Protein Names:Recommended name: CASP-like protein BLE3 Alternative name(s): Protein brassinolide-enhanced 3 Short name= OsBLE3 Short name= Protein BL-enhanced 3
Gene Names:Name:BLE3 Ordered Locus Names:Os05g0245300, LOC_Os05g15630 ORF Names:OsJ_017008, OSJNBa0037H06.9
Expression Region:1-162
Sequence Info:full length protein
