Skip to product information
1 of 1

Gene Bio Systems

Recombinant Oryza sativa subsp. japonica Aquaporin PIP 1-3(PIP1-3)

Recombinant Oryza sativa subsp. japonica Aquaporin PIP 1-3(PIP1-3)

SKU:CSB-CF866014OFG

Regular price $2,294.60 CAD
Regular price Sale price $2,294.60 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Oryza sativa subsp. japonica (Rice)

Uniprot NO.:Q9SXF8

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MEGKEEDVRLGANRYTERQPIGTAAQGAEEKDYREPPAAPVFEVEELTSWSFYRAGIAEF VATFLFLYISILTVMGVNKSASKCATVGIQGIAWSFGGMIFALVYCTAGISGGHINPAVT FGLFLARKLSLTRAVFYMAMQCLGAICGAGVVKGFQRGLYMGSGGGANAVNPGYTKGDGL GAEIVGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPAR SLGAAIVYNRAHAWHDHWIFWVGPFIGAALAAIYHVVVIRAIPFKSRD

Protein Names:Recommended name: Aquaporin PIP 1-3 Alternative name(s): OsPIP1;3 Plasma membrane intrinsic protein 1-3 Water channel protein RWC3 Short name= RWC-3

Gene Names:Name:PIP1-3 Synonyms:RWC3 Ordered Locus Names:Os02g0823100, LOC_Os02g57720 ORF Names:OJ1136_C04.6, OsJ_008613

Expression Region:1-288

Sequence Info:full length protein

View full details