Skip to product information
1 of 1

Gene Bio Systems

Recombinant Oryza sativa subsp. japonica Aquaporin NIP2-1(NIP2-1)

Recombinant Oryza sativa subsp. japonica Aquaporin NIP2-1(NIP2-1)

SKU:CSB-CF744376OFG

Regular price $2,310.00 CAD
Regular price Sale price $2,310.00 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Oryza sativa subsp. japonica (Rice)

Uniprot NO.:Q6Z2T3

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MASNNSRTNSRANYSNEIHDLSTVQNGTMPTMYYGEKAIADFFPPHLLKKVVSEVVATFL LVFMTCGAAGISGSDLSRISQLGQSIAGGLIVTVMIYAVGHISGAHMNPAVTLAFAVFRH FPWIQVPFYWAAQFTGAICASFVLKAVIHPVDVIGTTTPVGPHWHSLVVEVIVTFNMMFV TLAVATDTRAVGELAGLAVGSAVCITSIFAGAISGGSMNPARTLGPALASNKFDGLWIYF LGPVMGTLSGAWTYTFIRFEDTPKEGSSQKLSSFKLRRLRSQQSIAADDVDEMENIQV

Protein Names:Recommended name: Aquaporin NIP2-1 Alternative name(s): Low silicon protein 1 NOD26-like intrinsic protein 2-1 OsNIP2;1 Silicon transporter LSI1

Gene Names:Name:NIP2-1 Synonyms:LSI1 Ordered Locus Names:Os02g0745100, LOC_Os02g51110 ORF Names:OJ1118_G04.16, OJ1734_E02.43, OsJ_008085

Expression Region:1-298

Sequence Info:full length protein

View full details