Skip to product information
1 of 1

Gene Bio Systems

Recombinant Oryza sativa subsp. indica Peroxisomal membrane protein 11-4(PEX11-4)

Recombinant Oryza sativa subsp. indica Peroxisomal membrane protein 11-4(PEX11-4)

SKU:CSB-CF312491OFF

Regular price $2,196.60 CAD
Regular price Sale price $2,196.60 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Oryza sativa subsp. indica (Rice)

Uniprot NO.:Q01IH3

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSAGDTLDKLVVFLAKRDGIDKLVKTFQYVSKLAHWAAESSSPGLAGRAKNWETSAGLSR KAFRTGRFLTGLNGLRRAPGEFGALAVLANAGEMVYFFFDHFTWLSRVGVLDAWLARRMS FISAFGESVGYVFFIAMDLIMIRRGLRQERKLLREGGKDKDKEVKKIRMDRVMRLMATAA NVADLVIGIADIEPNPFCNHAVTLGISGLVSAWAGWYRNWPS

Protein Names:Recommended name: Peroxisomal membrane protein 11-4 Alternative name(s): OsPEX11-4 Peroxin-11-4

Gene Names:Name:PEX11-4 ORF Names:OsI_016204, OSIGBa0159I10.12

Expression Region:1-222

Sequence Info:full length protein

View full details