Skip to product information
1 of 1

Gene Bio Systems

Recombinant Oryza sativa subsp. indica CASP-like protein OsI_15195 (OsI_15195, OSIGBa0131F24.1)

Recombinant Oryza sativa subsp. indica CASP-like protein OsI_15195 (OsI_15195, OSIGBa0131F24.1)

SKU:CSB-CF488328OFF

Regular price $2,178.40 CAD
Regular price Sale price $2,178.40 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Oryza sativa subsp. indica (Rice)

Uniprot NO.:B8ARW3

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSKMAEEKVLAAPATVDGGMQSSGDLQASSAAAARVRPVETLLRAAPLGLCVAAMAIMLR NSVTNEYGTVSYSDLGGFKYLVYANGLCAAYSLASAFYIAVPRPATLSRSWVVFLLDQVF TYLILAAGAASAELLYLAYNGDKEVTWSEACGVFGGFCRQARTSVAITFASVACYILLSL ISSYRLFSAYDPPQPSLGNKGVEIAAFPR

Protein Names:Recommended name: CASP-like protein OsI_15195

Gene Names:ORF Names:OsI_15195, OSIGBa0131F24.1

Expression Region:1-209

Sequence Info:full length protein

View full details