Skip to product information
1 of 1

Gene Bio Systems

Recombinant Oryza sativa Photosystem II reaction center protein Z(psbZ)

Recombinant Oryza sativa Photosystem II reaction center protein Z(psbZ)

SKU:CSB-CF313566OCO

Regular price $1,960.00 CAD
Regular price Sale price $1,960.00 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Oryza sativa (Rice)

Uniprot NO.:P0C429

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTIAFQLAVFALIVTSSVLVISVPLVFASPDGWSNNKNVVFSGTSLWIGLVFLVAILNSL IS

Protein Names:Recommended name: Photosystem II reaction center protein Z Short name= PSII-Z

Gene Names:Name:psbZ

Expression Region:1-62

Sequence Info:full length protein

View full details