Recombinant Ornithodoros moubata Tick anticoagulant peptide

Recombinant Ornithodoros moubata Tick anticoagulant peptide

CSB-YP325525OCK
Regular price
$1,169.57 CAD
Sale price
$1,169.57 CAD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 22-32 working days

Research Topic: Others

Uniprot ID: P17726

Gene Names: N/A

Organism: Ornithodoros moubata (Soft tick) (Argasid tick)

AA Sequence: YNRLCIKPRDWIDECDSNEGGERAYFRNGKGGCDSFWICPEDHTGADYYSSYRDCFNACI

Expression Region: 1-60aa

Sequence Info: Full Length

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

MW: 9 kDa

Alternative Name(s):

Relevance: TAP is a slow, tight-binding inhibitor of blood coagulation, specific for factor Xa.

Reference: "Tick anticoagulant peptide (TAP) is a novel inhibitor of blood coagulation factor Xa." Waxman L., Smith D.E., Arcuri K.E., Vlasuk G.P. Science 248:593-596(1990)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.