Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 22-32 working days
Research Topic: Others
Uniprot ID: P17726
Gene Names: N/A
Organism: Ornithodoros moubata (Soft tick) (Argasid tick)
AA Sequence: YNRLCIKPRDWIDECDSNEGGERAYFRNGKGGCDSFWICPEDHTGADYYSSYRDCFNACI
Expression Region: 1-60aa
Sequence Info: Full Length
Source: Yeast
Tag Info: N-terminal 6xHis-tagged
MW: 9 kDa
Alternative Name(s):
Relevance: TAP is a slow, tight-binding inhibitor of blood coagulation, specific for factor Xa.
Reference: "Tick anticoagulant peptide (TAP) is a novel inhibitor of blood coagulation factor Xa." Waxman L., Smith D.E., Arcuri K.E., Vlasuk G.P. Science 248:593-596(1990)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.