
>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug
Updated Date: Stock Protein updated on 20171018
Research areas: Others
Target / Protein: N/A
Biologically active: Not Tested
Expression system: E.coli
Species of origin: Ornithodoros moubata (Soft tick) (Argasid tick)
Delivery time: 3-7 business days
Uniprot ID: P17726
AA Sequence: YNRLCIKPRDWIDECDSNEGGERAYFRNGKGGCDSFWICPEDHTGADYYSSYRDCFNACI
Tag info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
Expression Region: 1-60aa
Protein length: Full Length
MW: 27.0 kDa
Alternative Name(s):
Relevance: TAP is a slow, tight-binding inhibitor of blood coagulation, specific for factor Xa.
Reference: "NMR solution structure of the recombinant tick anticoagulant protein (rTAP), a factor Xa inhibitor from the tick Ornithodoros moubata." Antuch W., Guntert P., Billeter M., Hawthorne T., Grossenbacher H., Wuethrich K. FEBS Lett. 352:251-257(1994)
Purity: Greater than 85% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.