Recombinant Ornithodoros moubata Tick anticoagulant peptide

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Ornithodoros moubata Tick anticoagulant peptide

CSB-EP325525OCK
Regular price
$1,066.00 CAD
Sale price
$1,066.00 CAD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20171018

Research areas: Others

Target / Protein: N/A

Biologically active: Not Tested

Expression system: E.coli

Species of origin: Ornithodoros moubata (Soft tick) (Argasid tick)

Delivery time: 3-7 business days

Uniprot ID: P17726

AA Sequence: YNRLCIKPRDWIDECDSNEGGERAYFRNGKGGCDSFWICPEDHTGADYYSSYRDCFNACI

Tag info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Expression Region: 1-60aa

Protein length: Full Length

MW: 27.0 kDa

Alternative Name(s):

Relevance: TAP is a slow, tight-binding inhibitor of blood coagulation, specific for factor Xa.

Reference: "NMR solution structure of the recombinant tick anticoagulant protein (rTAP), a factor Xa inhibitor from the tick Ornithodoros moubata." Antuch W., Guntert P., Billeter M., Hawthorne T., Grossenbacher H., Wuethrich K. FEBS Lett. 352:251-257(1994)

Purity: Greater than 85% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share