
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Oncorhynchus tschawytscha (Chinook salmon) (King salmon)
Uniprot NO.:P69307
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MTPVHFSFTSAFILGLMGLAFHRTHLLSALLCLEGMMLSLFIALSLWALQMEATGYSVAP MLLLAFSACEASAGLALLVATARTHGTDRLQSLNLLQC
Protein Names:Recommended name: NADH-ubiquinone oxidoreductase chain 4L EC= 1.6.5.3 Alternative name(s): NADH dehydrogenase subunit 4L
Gene Names:Name:MT-ND4L Synonyms:MTND4L, NADH4L, ND4L
Expression Region:1-98
Sequence Info:full length protein