Recombinant Oncorhynchus mykiss Transforming growth factor beta-1(TGFB1)

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Oncorhynchus mykiss Transforming growth factor beta-1(TGFB1)

CSB-YP023446OEI
Regular price
$1,263.14 CAD
Sale price
$1,263.14 CAD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 22-32 working days

Research Topic: Signal Transduction

Uniprot ID: O93449

Gene Names: TGFB1

Organism: Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri)

AA Sequence: QTTTEEICSDKSESCCVRKLYIDFRKDLGWKWIHEPTGYFANYCIGPCTYIWNTENKYSQVLALYKHHNPGASAQPCCVPQVLEPLPIIYYVGRQHKVEQLSNMIVKSCRCS

Expression Region: 271-382aa

Sequence Info: Full Length

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

MW: 15 kDa

Alternative Name(s): Short name: TGF-beta-1

Relevance: Likely to be an important cytokine regulating immune response. May also have a role in other physiological systems.

Reference: "Isolation of the first piscine transforming growth factor beta gene: analysis reveals tissue specific expression and a potential regulatory sequence in rainbow trout (Oncorhynchus mykiss)."Hardie L.J., Laing K.J., Daniels G.D., Grabowski P.S., Cunningham C., Secombes C.J.Cytokine 10:555-563(1998)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share