Gene Bio Systems
Recombinant Oligotropha carboxidovorans Large-conductance mechanosensitive channel(mscL)
Recombinant Oligotropha carboxidovorans Large-conductance mechanosensitive channel(mscL)
SKU:CSB-CF475989OED
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5)
Uniprot NO.:B6JGA5
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MLKEFREFAMKGNVVDLAVGVIIGAAFGAIVSSLVGDVIMPVIGAITGGLDFSNYFIGLS KEVTATNLVDAKKQGAVLAYGSFLTVTLNFLIIAFVLFIVIRLINRIKRSEEAKPAEAPA PTKDQVLLTEIRDILKTK
Protein Names:Recommended name: Large-conductance mechanosensitive channel
Gene Names:Name:mscL Ordered Locus Names:OCAR_5831, OCA5_c21850
Expression Region:1-138
Sequence Info:full length protein
