Gene Bio Systems
Recombinant Oceanobacillus iheyensis Probable disulfide formation protein(bdbC)
Recombinant Oceanobacillus iheyensis Probable disulfide formation protein(bdbC)
SKU:CSB-CF812435OAB
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831)
Uniprot NO.:Q8ERY3
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MKKLTKKAENLLLLIWVQAFLALAGSLFYSEVMNYVPCELCWYQRILMYPLVLIYGVAAI KKDISFALPGLFMSGIGLLVSTYHYLVQHVSIFQEVGGACSGSVPCNVIYVNYFGFISIP FMAGVAFLIIFVLHLLILREQGRKA
Protein Names:Recommended name: Probable disulfide formation protein Alternative name(s): Disulfide oxidoreductase Thiol-disulfide oxidoreductase
Gene Names:Name:bdbC Ordered Locus Names:OB1163
Expression Region:1-145
Sequence Info:full length protein
