Gene Bio Systems
Recombinant Oceanobacillus iheyensis Glycerol-3-phosphate acyltransferase 2(plsY2)
Recombinant Oceanobacillus iheyensis Glycerol-3-phosphate acyltransferase 2(plsY2)
SKU:CSB-CF349386OAB
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831)
Uniprot NO.:P59250
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MDYVIFGLVAYLLGSIPSALIVGKVGYNIDIREHGSGNLGATNTFRILGTKAGSIVTLAD ILKGTLATVLPQLFDANVYVLAIGLLAVVGHMYPIFAKFRGGKAVATSGGMILGMYPLLF VIMVTTFLLTLYISKYVSLSSIITGLVSLLITIFYQDLGLSIVVFLLSAIVCYRHRENIK RIKNGTEPKISWM
Protein Names:Recommended name: Glycerol-3-phosphate acyltransferase 2 Alternative name(s): Acyl-PO4 G3P acyltransferase 2 Acyl-phosphate--glycerol-3-phosphate acyltransferase 2 G3P acyltransferase 2 Short name= GPAT 2 EC= 2.3.1.n3 Lys
Gene Names:Name:plsY2 Ordered Locus Names:OB1689
Expression Region:1-193
Sequence Info:full length protein
