Skip to product information
1 of 1

Gene Bio Systems

Recombinant Nyctinomops laticaudatus Cytochrome b(MT-CYB)

Recombinant Nyctinomops laticaudatus Cytochrome b(MT-CYB)

SKU:CSB-CF658475NBAG

Regular price $2,129.40 CAD
Regular price Sale price $2,129.40 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Nyctinomops laticaudatus (Lesser broad-eared free-tailed bat) (Tadarida espiritosantensis)

Uniprot NO.:Q36590

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTNIRKSHPLIKIVNDAFIDLPAPSNISSWWNFGSLLGVCLIVQILTGLFLAMHYTSDTA TAFNSVTHICRDVNYGWLLRYLHANGASMFFICLYLHIGRGLYYGSYTYTETWNVGVILL FAVMATAFMGYVLPWGQMSFWGATVITNLLFAIPYIGTELVQWIWGGLSVDKATLT

Protein Names:Recommended name: Cytochrome b Alternative name(s): Complex III subunit 3 Complex III subunit III Cytochrome b-c1 complex subunit 3 Ubiquinol-cytochrome-c reductase complex cytochrome b subunit

Gene Names:Name:MT-CYB Synonyms:COB, CYTB, MTCYB

Expression Region:1-176

Sequence Info:full length protein

View full details