Skip to product information
1 of 1

Gene Bio Systems

Recombinant Nostoc sp. NAD(P)H-quinone oxidoreductase subunit L(ndhL)

Recombinant Nostoc sp. NAD(P)H-quinone oxidoreductase subunit L(ndhL)

SKU:CSB-CF852324NHR

Regular price $1,761.25 CAD
Regular price Sale price $1,761.25 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Nostoc sp. (strain PCC 7120 / UTEX 2576)

Uniprot NO.:Q8YMW5

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MIVPLLYLALAGAYLLVVPVALLFYLKLRWYVVSSIERTFMYFLVFLFFPGLLVLSPFVN LRPRPRKIEV

Protein Names:Recommended name: NAD(P)H-quinone oxidoreductase subunit L EC= 1.6.5.- Alternative name(s): NAD(P)H dehydrogenase I subunit L NDH-1 subunit L NDH-L

Gene Names:Name:ndhL Ordered Locus Names:asr4809

Expression Region:1-70

Sequence Info:full length protein

View full details