Gene Bio Systems
Recombinant Nostoc sp. Cytochrome b6-f complex iron-sulfur subunit 2(petC2)
Recombinant Nostoc sp. Cytochrome b6-f complex iron-sulfur subunit 2(petC2)
SKU:CSB-CF846342NHR
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Nostoc sp. (strain PCC 7120 / UTEX 2576)
Uniprot NO.:Q93SW8
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MDDTLNQANPSMSRRQLLNFFTGAIVATTASAAIYPATKFFMPPAESTDAEGGILAQDKI GHPIPASQILAQASGTRALIAGLAGEPTYLTVREDGTLDPMGIVNNCTHLGCTFPWNPVD QQFQCPCHGSRYDAQGSVERGPANRPLKLVQVQVKDDYIWISPWQETDPRTGEKPWWV
Protein Names:Recommended name: Cytochrome b6-f complex iron-sulfur subunit 2 EC= 1.10.9.1 Alternative name(s): Plastohydroquinone:plastocyanin oxidoreductase iron-sulfur protein 2 Short name= ISP 2 Short name= RISP 2 Rieske iron-sulfur
Gene Names:Name:petC2 Ordered Locus Names:all4511
Expression Region:1-178
Sequence Info:full length protein
