Size: 20ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 25-35 working days
Research Topic: Others
Uniprot ID: Q8YUQ7
Gene Names: alr2278
Organism: Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
AA Sequence: MYGLVNKAIQDMISKHHGEDTWEAIKQKAGLEDIDFFVGMEAYSDDVTYHLVGAASEVLGKPAEELLIAFGEYWVTYTSEEGYGELLASAGDSLPEFMENLDNLHARVGLSFPQLRPPAFECQHTSSKSMELHYQSTRCGLAPMVLGLLHGLGKRFQTKVEVTQTAFRETGEDHDIFSIKYEDSNLYDD
Expression Region: 1-189aa
Sequence Info: Full Length
Source: Baculovirus
Tag Info: N-terminal MBP-tagged and C-terminal 6xHis-tagged
MW: 65.2 kDa
Alternative Name(s):
Relevance:
Reference: "NO and CO differentially activate soluble guanylyl cyclase via a heme pivot-bend mechanism." Ma X., Sayed N., Beuve A., van den Akker F. EMBO J. 26:578-588(2007)
Purity: Greater than 85% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer，50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.